007
Hugh Jackman just joined the ranks of actors looking to be the next Bond, James Bond.
Its becoming a rather long list, Ioan Gruffudd, Jeremy Northam, Paul Bettany and Clive Owen are already on it.
Jackman ruined all the others chances, he has the perfect looks, the body, the humor, and he's a boxoffice hit actor.
And on top of it all he's 35 years old, the perfect Bond...
So bye bye other guys, looks like it Wolverine all the way....
Spidey 2
Sony just put up a new Spider-man 2 poster. It has Doc Ock reflecting in spideys eyes. The movie itself is planned for July 2nd 2004
Troy
Another poster for the movie Troy, with Brad Pitt on it as Achilles.
Should be a nice movie this :)
Orlando Bloom is also in it, and he was just confirmed for the lead in Ridley Scotts new Epic movie The Kingdom of Heaven.
| posted by merc, 3:47 PM
| 0 comments
|
Flirting : Only 1,6% of all men recognize all the ways a woman can flirt with them. Things like listening to their every word didnt seem like flirting to most men, they just thought they were actually interresting...weirdo's!
Gambling : Kim David Faithfull, an Australian bank employee managed to gamble away 19,6 million of the banks dollars on the internet... He's off to jail for some 5 years...expensive holiday :P Nice name though :P
Amateurs : A bunch of thiefs that stole license plates from cars have send the stolen goods to the police office after they got remorse. Along with the plates they also send 20 euro's with each of the plates to make up for damage they may have caused. They were drubk though, but still, heh, silly ass fake crimenals :P
More gambling : 4 large internet corperations from The Netherlands have made a bettingpool for when the Pope will die and who will be the next Pope. The most mentioned was february 7th with Cardinal Simonis as the next Pope, stay tuned... Heh, I say the 26th of december, also with Simonis as the next Pope...
www.popecountdown.com
Security : The Netherlands are #1!!!!!!! For worst internet security.... A British research requested by McAfee showed that 43% of Dutch internet companies arent secured against the latest virusses. Britain was 2nd with 42%. Them darn Germans were last with only 12%.
Just some fluffy animals :
| posted by merc, 10:59 AM
| 0 comments
|
Sober...?
What's that ? Sober ?
I have no idea! Heh, nah, it's a new virus, a computer virus that is :)
W32.Sober@mm is a nice little e-mail virus that sends out random e-mails from your computer.
It doesn't really hurt the computer though, just your reputation...
It's usually an attachment on a German or English e-mail and gives a error message after opening it, heh, i get those plenty :P
So you be carefull not to get Sober now!!!! :P
Fact : Microsoft's biggest settlement cost them 1,1 billion dollars. This was in California, a recent settlement with 5 American states about too high prices cost them 200 million dollars.
American kids dumb cos of t.v
Uhuh, they are dumb for a reason it seems ;)
American kids between 6 months and 6 years old that live in a house that constantly has a tv on or with a tv in their room dont learn how to read as fast as other kids.
34% of these kids know how to read between the time they are 4 and 6 years old. Compared to the 56% of the other kids this is a big difference.
It's not asif they dont read at all, 80% of all American kids in that age reads or is told stories. They do this 49 minutes a day, thats not much compared to the 2 hours and 22 minutes they spend watching tv and playing computer games though.
There are more silly stats, but who caress eh ?
PS2 Engine stolen ?
The Wisconsin Alumni Research Foundation (WARF), has filed a complaint against Sony and Toshiba. They represent the patents for the University of Wisconsin. They dont want to clarify the actual complaint just yet but say it has to do with the Emotion Engine that Sony and Toshiba developed specially for the PS2.
Fact : P. Diddy and Jay-Z's clothesline both exploit the workers in the factories in Honduras. 24 dollarcents per shirt, 12 hour shifts, contaminated water, stripsearches, pregnancy tests, get pregnant and lose your job. Darn, that's nice of Puff Diddy and Jay-Z....
Uhm, where did that guys hand go....?
Brasil claims to have the worlds biggest ox...looks photoshopped to me :P
Darn thats fancy parking :P
| posted by merc, 11:02 AM
| 0 comments
|
Apple Supercomputer...
A supercomputer created by Apple has just entered the top5 of most calculations per second on spot number 4.
The computer is made up of 2200 G5 processors (so thats 1100 dual-processors from regular G5's)
They can now reach a speed of 8,1 teraflops, 1 teraflop being 1.000.000.000.000 calculations per secomd...and this isnt at full capacity.
A normal supercomputer costs between 100 and 250 million (!) dollars to build, the Apple only cost 5 million and was build in only 1 month time.
The 8,1 teraflops is supposedly only 48% of the theoretic peak a computer can reach, but according to some far more is possible...
King of the Dead...
Yup yup! Elvis does it once again...
For the 3rd time in a row Elvis reached the #1 spot in the "moneymaking dead" list of Forbes magazine.
On #2 is Charles Schultz, Snoopy's creator. And 3rd ? Thats J.R.R Tolkien, he shot up to third place thanks to the hype created by the movies...
Elvis gained 40 million dollars this yearl, pretty nice for a guy that died 26 years ago. Schultz got "only" 32 million dollars. Tolkien got 22 million, beating John Lennon by 3 million. Another ex-Beatle got 3 million less, giving him the #4 spot, George Harrison (no Paul aint dead!).
Its mostly musicians in the top. Besides Elvis, Harrison and Lennon there are also Sinatra, Tupac, Marley and Hendrix. And composers like Irving Berlin, Rodgers and Hammerstein.
Nice Airstrip :P Its in the Maledives, 1192 islands that form a country. Every holiday resort is like a country on its own though...
Ghettopoly, its causing a rage in American cities cos of the stereotypes.
Darn, thatsa nice lil Aquarium, the largest window in the world, in Japan.
| posted by merc, 11:14 AM
| 0 comments
|
Okay, here is the deal...I need an Avatar....
This is not a competition...unless you count honor as a prize....:P
So anyway, I've been kinda not looking for one for a while now. So im getting nowhere...as always.
So I wondered if any of you lot would want to make some suggestions. There are some criteria though :
1. I want to play a man, thats man as in male...so basicly I want a male avatar, so no drag for the merc.
2. See rule 1.
So uhm, thats it really.
The idea is to find either a pic on the internet you like yourself for me to wear. Or...find a picture that you think merc the player looks like. Some trades of merc ? Well, hes hyperactive, annoying, he hates authority, sees typo's all over DQ.net and generally doesnt have the slightest idea on how to play this game after 5 Era's...oh, and the ability to be serious...well...he lacks that, kinda.... He is also a great team player though, and a great Wizard and Merchant in the past. He used to be in ID and still wears the Kingdom name proudly as a Province name....
Oh and if you kinda hate me, or really hate me, please also post a pic, oh, and vent your feelings on me a bit, I can take it :)
So i did mention you cant win anything right ? Okay...
Unless you want my autograph or uhm, something...
| posted by merc, 2:17 PM
| 0 comments
|
Drugs are Sexy!
Dutch researchers reported that an orgasm is like a shot of heroine...
How did they find out...?
Well, they had couple have sex in a PET-scan...
Yup yup, they had to hold their head still as they had their orgasm though, so they practiced...:P
They also had to ejaculate within 7 minutes of having the orgasm...
Hmm, reminds me of the weirdo x-ray sex pics...
Worlds Oldest Man dead...
The 122 year old Cambodjan tiger hunter Sek Yi died this weekend.
He was the oldest man alive although not recognized by the guiness book of records cos his papers had been burned during the Regime of Pol Pot. He says he owes it all to tabacco and prayer...
So instead the Japanese Hongo Kamato got the title with his 116 years of age.
The oldest recorded human is still Jeanne-Louise Clemant from France with 122 years and 164 days.
Germany has best gamers on earth...
Yup, or so thy say in South-Korea.
The germans won the World Cyber Games in South-Korea. Second and third were South-Korea and Taiwan...and fourth...The Netherlands...yay!
The germans won 5 medals, among wich a gold against holland in the finals of Fifa Soccer 2003. Bastards!!! The Dutch got 1 gold, 2 silver and a bronze and won themselves 20.000 euro's this way. The total prize money was 300.000 euro's.
Fifa Soccer 2003, Age of Mythology and Warcraft III were among the 8 games that were played....
Hmm, i knew there were a lot of germans, but them being the best...? I beat them all the time in BF42, real ones, not the bots :P
Pamela Anderson Dying...
Pamela told Howard Stern in an interview on the radio that she has a liver disease and will most probably die in 5-10 years.
It was discovered after they found she had Hepatitis C.
She is trying to live as healthy as possible so she can see her 2 sons, who are now 7 and 5 grow up to be 21...
Sad that, not that im a fan or anything, but all loss of life is sad, well, almost all anyway...
Shorts.
According to researcher Misael Bordier the poison of the Cuban Scorpion can be used as medice against some types of cancer...
...while in Bangkok they eat the buggers.
And this ? This is the false document Josef mengele used to get into Argentina after WW2. Argentine is opening all her old files.
| posted by merc, 1:36 PM
| 0 comments
|
There are many organisations that rate game content.
The ELSPA , ESRB and PEGI are but a few. There are many national rating systems too.
They give games certificates according to their content. (and most also rate tv-programs and video/dvd recordings)
They are categorized in 4-6 different groups. Ranging from 3+ to 18+ (some porn even has extra rules on them, dont ask me how i know :P)
This is to prevent children from playing games that may damage them or give them wrong ideas. It's still too often we read stories about silly kids reinacting a scene from a movie or a game. Like Driver or Grand Theft Auto for instance. And then there is the music discussion, but thats not important right now.
ESBR : The Entertainment Software Rating Board (ESRB) ratings are designed to provide information about video and computer game content, so you can make informed purchase decisions. ESRB ratings have two parts: rating symbols suggest age appropriateness for the game, and content descriptors indicate elements in a game that may have triggered a particular rating and/or may be of interest or concern.
To take full advantage of the ESRB rating system, it's important to check both the rating symbol (on the front of the game box) and the content descriptors (on the back of the game box).
I understand FaitH doesnt have a box. But common sense makes me believe these rules, which are only designed to inform people and guide them in their purchases, apply to any game.
The list of descriptors is quite long, and most apply to FaitH in one way or an other.
ESRB Content Descriptors :
Alcohol Reference - Reference to and/or images of alcoholic beverages *
Animated Blood - Cartoon or pixilated depictions of blood *
Blood - Depictions of blood * (bit double with the prior though)
Blood and Gore - Depictions of blood or the mutilation of body parts * (ditto)
Cartoon Violence - Violent actions involving cartoon-like characters. May include violence where a character is unharmed after the action has been inflicted *
Comic Mischief - Scenes depicting slapstick or gross vulgar humor (dunno for sure)
Crude Humor - Moderately vulgar antics, including bathroom humor *
Drug Reference - Reference to and/or images of illegal drugs
Edutainment - Content of product provides user with specific skills development or reinforcement learning within an entertainment setting. Skill development is an integral part of product
Fantasy Violence - Violent actions of a fantasy nature, involving human or non-human characters in situations easily distinguishable from real life *
Gambling - Betting like behavior *
Informational - Overall content of product contains data, facts, resource information, reference materials or instructional text
Intense Violence - Graphic and realistic-looking depictions of physical conflict. May involve extreme and/or realistic blood, gore, weapons, and depictions of human injury and death (uhm, well, yea, kinda)
Mature Humor - Vulgar and/or crude jokes and antics including "bathroom" humor *
Mature Sexual Themes - Provocative material, possibly including partial nudity *
Mild Language - Mild references to profanity, sexuality, violence, alcohol, or drug use *
Mild Lyrics - Mild references to profanity, sexuality, violence, alcohol, or drug use in music
Mild Violence - Mild scenes depicting characters in unsafe and/or violent situations *
Nudity - Graphic or prolonged depictions of nudity
Partial Nudity - Brief and mild depictions of nudity
Sexual Violence - Depictions of rape or other sexual acts *
Some Adult Assistance May Be Needed - Early Childhood Descriptor only
Strong Language - Profanity and explicit references to sexuality, violence, alcohol, or drug use *
Strong Lyrics - Profanity and explicit references to sex, violence, alcohol, or drug use in music
Strong Sexual Content - Graphic depiction of sexual behavior, possibly including nudity
Suggestive Themes - Mild provocative references or materials *
Tobacco Reference - Reference to and/or images of tobacco products
Use of Drugs - The consumption or use of illegal drugs
Use of Alcohol - The consumption of alcoholic beverages *
Use of Tobacco - The consumption of tobacco products
Violence - Scenes involving aggressive conflict *
* These can be found in FaitH, now i know some are double or dont state the exact things we see in FaitH, but hey, im not really rating it.
ELSPA : Entertainment and Leisure Software Publishers Association. These people use a near similar system, though they only put an age tag on the box.
3+ Some 67% of the games rated so far got this rating.
11+ 22% received this rating.
15+ 10% of all games got this as a rating.
18+ Only 1% was rated 18 years or older. But the number is growing slow but steady.
PEGI Pan European Game Information. The PEGI system belongs to the Interactive Software Federation of Europe (ISFE) which is based in Belgium. ISFE have contracted the administration of the system to the Netherlands Institute for the Classification of Audiovisual Media (NICAM) which is based in Holland. Yup yup, the dutch :)
3+
7+
12+
16+
18+
These ratings are pretty much the same as the ELSPA uses. The 7+ was added to account for scary things that might scare younger children, things like creaking doors and rustling bushes. Apart from these age ratings games will also have descriptors to show why a game has the rating it has. The are : Violence, Drugs, Fear, Discrimination, Sex/Nudity, Bad Language. Some of these have been shown on tv, though personally i like the dutch descriptors better :)
So i hope you now have a bit of an idea what we are playing. I myself, Silly merc, thought the chat and the forums were more or less 18+, but i now understand its more 7+, like the PEGI system. Anything more then a creaking door might scare our pants off :P
| posted by merc, 4:04 PM
| 0 comments
|
Well call me Dick and slap me silly...
In the hope to get compassion from the people he owed money a 24 year old Tanzanian cut off his dick.
He spend the millions of shillings they loaned him on hookers and alcohol instead of a business deal.
Some 2 months earlier in this region a man cut of his privates cos he owed 300,000 shillings (250 euro's) that he couldnt pay back...
Darn im glad people dont do that over here...
With the state of our economy right now there wouldnt be a man left, just a bunch of eunnichs...:P
Burglar sandwich...
The inhabitants of a house in Amsterdam had a surprise waiting when they came back from a holiday. They found a dead man trapped between their house and that of the neighboors. The man, presumably a burglar had been heard 6 days earlier on the roof. As the neighboors called the police the man had vanished, so the police left.
The man had most probably heard the police and on trying to run he had fallen into the 40 centimeter space between the 2 houses. He had dropped 3 floors and got stuck between the houses. During the 6 days the neighboors had heard moaning but thought it to be coming from outside somewhere.
The 40 centimeter space is visible from a house across the street, but those people were on holiday too...
We have that here too, the opening between houses i mean. But here we put a lid on it, silly people over there :P
Imagine being trapped for days and noone can hear you....eep!
We want more!!!
The Chinese after having had a man go up into space want more. Plans are now underway to build the worlds largest ferris wheel.
The wheel is the be 210 meter high, huge compared to the now biggest wheel, The Eye, in London which is 133 meters in diameter. Some 720 people are able to go round in the wheel at once.
The wheel will cost 86 million euro and will be financed by the European company Global Investment and Banking Corporation, it should be ready in 2007, the year before the Olympics in China.
The foot of the wheel will house shops, restaurants and a theater.
Highest Scraper...
Taiwan is now home to the worlds tallest building.
This friday the builders reached the highest point, at an amazing 508 meters.
The building isnt finished, it should be done next year. Its name ? The Taipeh 101, in Taipeh, the capitol of Taiwan.
The building will cost 1,7 billion dollars and can withstand hurricanes and earthquakes just fine. The record however isnt theirs for long. Shanghai is expected to have their building finished in 2007, and it should be higher...
The old record was held by the Petronas Twin Towers in Kuala Lumpur with 452 meters.
The Taipeh 101 will have 101 floors, 5 of these will be filled with stores and restaurants. The rest of the floors will be office space for some 100.000 workers.
The building also has the fastest elevator in the world. It climbs 89 floors in only 39 seconds...wow!
I wonder if you can lift gravity in the thing....I wouldnt want to be in it when someone hits the break button...
British (young) women drink most....
Yup yup, what we all knew has finally been made official. British women are alcoholics...:P
The research was done on women between 18 and 24 years old. They drink a whopping 203 liters per year... Thats 3,5 times what Italian women drink...
On second place were the German women with "only" 189 liters...and third was for Holland with 107 liters a year. Hmm, i expected less from us actually...
An earlier report stated that 40% of the British men and 22% of British women drank "too much", whatever that may be....:P Too much being 2 liters of beer per day for the men, and 3/4rd of a bottle of wine for then women...
Hmmm, but what if the women drank all the beer...?
Kazaa is losing ground in Europe and Israel...
Well, thats all really, Kazaa dropped below 50% of the market. And who are taking over ? Edonkey....
Uhm, okay...whatever... :P
They are slowly taking down all the Fasttrack stuff Kazaa depends on, so i guess we will all be moving on sooner or later....
She's finally here! Mouslim Barbie! Jippyyy! :P
Everybody can be a photographer these days...
2 rare Red Panda's were born recently...lets hope they have more luck then last weeks turtle...
Is it just me or do they have weird election posters in switserland...are they playing neutral again ?
Just filling up the donkey...
| posted by merc, 5:07 AM
| 0 comments
|
Gomi treated us to a little visit. As always most players welcomed him, followed by a flood of questions.
Ive put together a little log of some questions, and some answers.
Those of you who missed this quality time with a god, read on....:P
His entrance...
[01:15] * Gomi has joined #faith
[01:15] * X2 sets mode: +o Gomi
[01:15] |X2| [Gomi] |merc| i hear creators are really insane hermits
[01:15] |JonColdFootSnow| GOMI!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
[01:15] |Galas| oh my god
[01:15] * Shade|awaY blinks.
[01:15] |Gomi| .userlist
[01:15] |Galas| it lives!
[01:15] |Gomi| it? lol
[01:15] * Twilyght waves to gomi
On Red Drago Awards...
[01:20] |Gomi| red dragos are dead
[01:21] |Gomi| it would be impossible to run red dragos soon anyway
[01:21] |Jix| Jonsnow :) ill do reddragos on my blog!
[01:22] |Gomi| red dragos are copyrighted dcs!!
[01:22] |Gomi| do your own stupid awards :)
On Era 6 users and servers...oh, and Divine Chat...
[01:25] |Jix| Yah we were talking to terin about next era gomi....you think well get in the 10ks of players?
[01:25] |Gomi| terin expect 2-6k
[01:25] |Gomi| I think we might have to cap it at 6k
[01:25] |JonColdFootSnow| man noone will beable to say anything with that many people in here
[01:25] |Gomi| thats why the divine chat will be needed soon i guess lol
[01:26] |Gomi| we wont have 6k p2p players in 1 era
[01:26] |Gomi| beta was 3k with 0 ads
[01:26] |Gomi| era 0 was 2k
[01:27] |Gomi| no doubt but 6k p2p is impossible... they have to try before they buy :)
[01:27] |Jix| what happens if we get 15k lol
[01:27] |Gomi| i think it can handly up to 8-10k
[01:27] |JonColdFootSnow| ya when is divine chat coming out
[01:27] |Gomi| its not for now jon, i'm still the only one using
[01:27] |Jix| what happens if we get 15k lol
[01:27] |Gomi| we'll cap before that it lol
[01:27] |JonColdFootSnow| then gomi takes all our money and runs
[01:27] |Jix| capping...ouch
[01:28] |Gomi| or rent another server
[01:28] |Gomi| in my head, faith isnt launched yet :)
[01:28] |Jix| when does it launch?
[01:28] |Gomi| era 6 is the launch... kinda :)
[01:29] |Gomi| im pretty happy with the game right now (took me a year but still lol)
On us...
[01:31] |Gomi| i like our community
[01:31] |Gomi| just need to grow it :)
On flamers...
[01:59] |Gomi| is faith uncut still alive btw or do i redirect flamers to nothingness?
[02:02] * Gomi has left #faith
So there you have it people...News from the source...
| posted by merc, 5:08 AM
| 0 comments
|
It's just a little merc doodle...i get bored you know...
Well, i used to get bored anyway, now im caught up in reading for the thread Phantym started in the forums. Who would have guessed i would actually learn something from playing FaitH eh ?
Part from being nice to people really. Being nice is hard you know...;) Not really, but not swearing/cursing/cussing/whatever in a 18+ game...well, it just doesnt fit :P
And did you see that newbie the other day, lolz! An 11 year old that talked more filth then Jo in a stripclub... ;)
(just kidding Jo, you are all action, no talks...;P)
But anyway, so i doodle, so what ?
Whatever happened to that FaitH player art website ? You know, the one with the homemade FaitH skins ?
I'm hoping to see more playerart and more DQ stuff up, and maybe some more original new ideas for columns ?
Yup, cos its entertainment we want, we being the masses...well, next era will see enough new people looking for entertaining stuff anyway, to kill the waiting time they didnt expect, or love...uhm, yea...
| posted by merc, 1:10 PM
| 0 comments
|
German Shepperd....
A man Berlin, Germany, was arrested for teaching his dog the Hitler greet. He has to apear in court for : "Using signs (handgestures) of unconstitutional organisations"
His black sheperd, Adolf, raised its right paw on command. He first did it while in the presense of 2 police-officers, the act was repeated a few times more that day...
Heh, what happened to playing fetch eh ? :P
Weirdo, next time call it Napoleon and have it walk around in a nice hat with its paw against its breast :P
Or maybe uhm, uhmmmmmm, yea...
Poor Adolf...he doesnt look like last weeks Adolf...
Punishing Angels...
The man I reported about a week or so ago, who helped an 81 year old women end her life heard the judge sentence him to 1 year of which 8 months parole with a probational period of 2 years. Another court had spoken the same sentence earlier. The convicted man stated : "The court acted like a religious court, you expect these kind of trials in Iran, not The Netherlands..."
His lawyer, a well respected one, stated that the court felt the need to reopen the discusion on euthanasia, a rather weird move. He also mentioned this case was somewhat hard cos it was on the thin line of acceptable euthanasia and murder.
New Project.
The creators of Kazaa, Niklas Zennstrom and Januss Friis, are busy working on a new project. Its called Skype and like Kazaa its p2p (peer-to-peer). Skype will allow people to make telephone calls via internet, for free. With special software, a headset, a microphone and a broadband connection you are set to make free calls all over the world. That is, if the person you are looking to call uses Skype too...:)
Right new Skype is in beta testing (version 0.93) They just updated and the sound quality is much better, as is USB support and more Soundcards can be used now.
The Skype software lets you create and manage lists of friends and contacts with who you can then call. There are no central servers this way, just like Kazaa.
So uhm, how illegal will this be ? :P I guess not, not yet anyway. Here in holland we have UPC, a cable distributer doing the same, kinda. They offer the ability to pay 60 euro's for free calling each month, instead of a set rate per minute. Weird that, and doesnt MSN allow Video chat, and sound chat...? Oh well...
Oh, and uhm, after yesterdays blog, Dell gave in to HCC...:P
Short copy/pasted news....
1. The University of Victoria in British Columbia, Canada, is hosting a special seminar entitled "Bondage 101" to teach participants how to use ropes safely in a sexual context.
2. A "school for soubrettes" that teaches young Italian women the not-so-subtle skills needed to become television game show hostesses and showgirls has opened near Naples backed by generous European Union funding.
The programme at the First Tel School has prompted a political storm over the EU's willingness to put £1 million into what critics say is a "course for bimbos". 1200 women applied for the 97 available places, as did a few men.
3. ereHay isway inklay otay away Englishway otay igPay atinLay anslatortray, enjoyway!
http://www.onlineconversion.com/pig_latin.htm
4. And here is a nice insult generator you ooze orifice of a Hijkakian Yemzid...uhm, yea...!
http://www.getodd.com/fun/insult/insult.html
And this poor bugger is most probably the last Soft-Shell Giant Turtle on earth...he/she lives in a lake in Vietnam.
Shame on us!
| posted by merc, 10:50 AM
| 0 comments
|
Minister of car-theft
The former Iraqi Minister of Information Mohammed Saeed al-Sahhaf has been accused of car theft. Just before Bagdad was taken by the Americans he took 10 government cars from the National Museum parkinglot, at gunpoint...
The Museum staff informed the police after things settled down in Bagdad. If the accusations are found to be true there will be a warrant for the arrest of Mohammed Saeed al-Sahhaf, the former Iraqi Minister of Information, or Comical Ali, as he is called by most :)
He is now in the United Arabian Emirates, i wonder if there will be a bounty on his head...:P
Val Kilmer the B actor...
Nope, the B aint for Batman. Val was spotted at the Collectors and Celebrities Show in LA, a show for fans, collectors and b-actors and b-actresses.
So what was our popular Val doing there ? Well, he was SELLING pictures and autographs!! For the small fee of $50 he will let you take his picture, or he would sign an autograph, just for you.
In 2 days he got some 60-100 thousand dollars with it!!
Oh uhm, and he was also promoting his new movie....uhm...Wonderland...
Guess hes Val "scam artist" Kilmer now....
British schoolkids punished
A headmaster of a school in Cheddar (SW-England) punished a group of kids cos they didnt wear the expensive uniform to school. He put them in a classroom together, didnt allow them to talk and shortened their time inbetween classes.
So what were they wearing...? Well, instead of the 38 Euro uniform from the "official" supplier they bought the 25 Euro imitation jacket from the supermarket. Darn them, darn them to hell!!!!
The parents complained to the ministry of education cos of the treatment.
The headmaster states that the punishment seems to have worked, cos almost all children come to school in the "official" uniform, and he is getting a lot of compliments about the classy appearance of his students....Well jippyyyyy!
Fighting Giants
The dutch consumers organisation is sueing Dell. The user agreement Dell uses is full of holes making it imposible for people to get any kind of help when something is wrong with their computer. The organisation, HCC, did the same with Microsoft a few years back, discussions are still going for that...
The bastards, still running their scam! Good thing i bought overpriced stuff from others...uhm...yea...
Amsterdam, capitol of cheap-ass land...
This monday all government employees of Amsterdam started a test to replace all Microsoft software with open-source software. This way they want to see how big the difference is in quality, speed, fragility to virusses and cost efficiency. The test will last some 6 months and will then be used to determine if Amsterdam will keep running on Microsoft products, costing some 100 million euro's for licensing, or use the free open-source "Open Office" software...
And they say we are cheap...? :P Or was that jusr me...? Wait, ill ask Twilyght...;)
Maxtor makes things...cheaper too
Maxtor will come with a new Hard Disk system, allowing for cheapr Hard Disk. The capacity will stay the same though, so uhm, yea, thats uhm, news...kinda...
I wonder why i even picked this...uhm, oh well...
The idea is to store more info vertically, but capacity wont change, so uhm, why make all the research costs to make something cheaper...kinda...
Weirdo's!
Kill and attack! Uhm, most people hate these buggers.
Take that you forking ash hole! Oh wait, this aint in anyway the opinion of DCS...
Take that you fucking asshole!!!!!
Oh my! Thats a big pumpkin...its 402kg and from Swiss...hmmm...Smashing Pumpkins anyone...?
So that's why im straight...ewwww...and i can kick their asses too, haha!
Oh look, The Hulk is a Schumacher supporter too...;)
Aha! So thats why its called a header...? Weird goalie that :P
Then this is a give-header ?
Darn, its been a week, darn inactive merc...thats for not replying in the forums! ha!
(really im just lazy...:P)
| posted by merc, 11:26 AM
| 0 comments
|
It''s a kind of magic...
A magician was showing a trick in a the Amsterdam tram. He made his wallet go up in flames only to have reappear unburned.
The trick wasnt satisfactory to one viewer, so he decided to help him out a bit. He asked the magician to do the trick again, as the magician got his well-filled wallet out again the man pulled a knife, grabbed the wallet, and made himself disappear along with the wallet....:P
Teehee, silly ass, what kind of nutcase does tricks with his wallet or any other valuables in the metro ? I wouldnt even do it in church, let alone in the metro :P
Uhm, yea...
French are insane...
PARIS (reuters) - French schools are cracking down on a craze among teenage girls to flash their midriffs and wear skimpy G-strings that peek brazenly out from above their low-cut trousers.
OMG! I just blatently copy pasted that! Eep! But hey, whats worse, my c/p ing it, or the message itself ? Aha!
Suicide postponed...?
ST. PETERSBURG, Fla. (Reuters) - A suicide that was to have taken place during an internet rock concert Saturday night has been postponed, the Hell on Earth band said on its Web site. Oi!?
A note on a link to the site said both events had been postponed for a week. Darn, this is becoming a long running news item....:S
Funny news quote :
"If you're doing drugs, it's kind of a drag. You're a slave. It's kind of a weak thing to do."
-- comic actor JACK BLACK, recalling his own problems with drugs in the eighth grade.
Duh, uhm, yea, kinda weak, uhm, yea, duh, uhm, blah, yea....kinda....i think...
BAD!!!!!
SANTIAGO, Chile (Reuters) - Chile's Catholic Church, which is waging a campaign to block passage of a law legalizing divorce, will stop airing a controversial advertisement that said children of divorced couples are more likely to become drug addicts and criminals. Just that bit though :) The rest will go on as usual, darn divorcees!
Ironically, Chile's proposed divorce law would actually make it tougher to end a marriage, eliminating a loophole that tens of thousands of Chileans use to obtain a so-called nullity. Heh! Silly church people! Haha! Fighting the wrong thing, again!
In a nullity proceeding a husband and wife swear before a judge that they were married in the wrong district, not the one they were living in at the time.
Many Chilean judges, though aware the couple are lying, will then decree the marriage null and void. So uhm, arent the judges the loophole ? Hmmm...
Kidnapped!
MOSCOW (Reuters) - For a Russian electricity company, pets are not just for Christmas -- they are for ransom.
Russia's First Channel television reported Dalenergo, an electricity company in Russia's Far Eastern city Vladivostok, is so frustrated by customers who owe around 300 million roubles (6 million pounds) that it has decided to confiscate their pets.
"Let the father answer his daughter's question as to why her favourite cat has been taken away," Dalenergo Director Nikolai Tkachyov told First Channel. Teehee! That'll show em!
Sad really :S
Bad Doctor!
Her name should have been a warning, but now a Spanish doctor has been ordered to pay 20-years child support to a woman called Concepcion who gave birth three years after he tried to sterilize her. Heh! Fool!
Pardon my French...
PARIS (Reuters) - Tired of being sniggered at, people from French villages whose names sound like "Filthy Swine" and "My Arse" plan a weekend get-together in a tiny hamlet whose name means "Eat Onions" in old French.
Among the 15 or so villages joining the event in the southwestern village of Mengesebes (Eat Onions in Occitan, an old language from the south of France) are: Saligos (which sounds like Filthy Swine), Montcuq (sounds like My Arse) and Trecon (Very Stupid).
Quirky French place names are nothing new to some English-speaking tourists who several times a year make off with signposts from the southwestern town of Condom. Lolz! Weirdo french, we have some weird towns too though...GroteGast (BigGuy) Sexbierum (uhm, SexBeerRum ? duh!) Meppen (Slapping) Dieren (Animals) De Engel (The Angel) Lollum (uhm, LOL ?) Handel (Merchandise) Monster (Monster ?) LutjesWinkel (uhm, hard to translate, uhm, Lutje = nowhere (as in nowhereville) winkel = store) Haren (Hairs) Oenkerk (NitwitChurch) Amerika (America ?) Helmond (Hellmouth, eat your heart out Buffy!) Boerenhol (Farmershole) Moddergat (Mudhole) Mooie Paal (Nice Pole, or nice dick, depends :P) Fonteinsnol (Fountainslut) Cocksdorp (Cocksville) Aarsmaderstrontveen (Assmaggotshit.... (dunno translation for veen, nothing special though)) Stampesgat (uhm, Bangershole) Glimmen (Shine) Doodstil (Deadquiet) Hongerige Wolf (Hungry Wolf) Electra (duh) Pannekoek (Pancake) Nooitgedacht (Neverthought) Muggenbeet (Musquitobite) Katlijk(Catcorpse) Sint-Nicolaasga (kinda uhm, Santa Fuck-off!) Hem (Him) Pluskut (Pluscunt)
We cant beat Austria though, they have Fucking :(
In Poland there is a little Island called Hell, people there earn money with greeting cards that say : Greetings from Hell, lolz!
Switzerland has Kloten (Balls) and Spain has Peniscola (yea)
No Name, Colorado
Pis Pis River, Nicaragua
Saint-Louis-du-Ha! Ha!, Quebec, Canada :P
Then there is this place in Tjechia called Kutna Hora, in German its Kuttenberg, and Kuttenberg is CuntsMountain in dutch :) They have a weirdo church there filled with human bones :
And Wales has silly little LLANFAIRPWLLGWYNGYLLGOGERYCHWYRNDROBWLLLLANTYSILIOGOGOGOCH
(Mary's church by the white hazel pool, near the fierce whirlpool,whit the church of Tysilio by the red cave.)
There is a station in Wales called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known.
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokai-
whenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand (aka Bangkok)which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.
I bet you lot know quite a few more, so uhm, you aint posting anything anyway, so screw you! ;)
| posted by merc, 10:46 AM
| 0 comments
|
Napster is back! Kinda...
Napster is returning to the music sharing scene...with a difference...
Starting october 9th Napster will launch a beta version of its new sharing system. This new system is a pay-per-song program. Napster will offer some 500.000 songs people can buy. More then Apple's Music Store and BuyMusic, similar businesses. That's about all the details that are known right now...
Napster had 60 million users once, before the court order came in ordering them to stop. The coorperation behind the lawsuit bought Napster and tried making it into a pay service, but it didnt work out, losing them their 85 million dollar investment, and getting them a bankrupt Napster.
Roxio bought the Napster franchise in 2002 for 5,3 million dollars, and are looking to launch it once again as a pay service...
Giving the finger...
Sony are coming with a fingerprint secured-USB stick. It will be available in 3 sizes, 64, 128 and 256 MB. The stick will be able to recognize 10 different prints and will allow you to secure files seperatly.
Silly Sony people eh ? :P Portable porn vaults....?
South Park :S...
Guess who are coming to South Park ? Jen and Ben. Who ? J-lo and Ben Affleck :(
Well, I hope they get flamed to a crisp :)
Their names will be Fat Butt and Pancake Face, sounds promising to me :)
Fat Butt will be singing "Taco, Taco, Burrito, Burrito, Fulfil all you wishes with my taco-flavoured kisses." after she gets dumped by her record label for a doll, and Pancake Face will try to get it on with the doll...
Dunno if this is old in America though...
Cookie mystery solved!!!
Finally! They solved the crumbled cookie problem! Yay!
Researchers discovered why some cookies do get crumbled in a pack while others dont...
The answer ? Vault lines! Yup, you heard me right...
Cookies that come out of the oven pick up moisture, making the edges expand, but the centre contracts due to moisture, thus creating vault lines...
When they are packaged and transported, these vaultlines cause certain cookies to crack, while others that dont have vaultlines, or less lines dont.
So yay! And guess what ? They will now start checking cookies for lines, so people dont buy crumbled cookies all the time! Yay!
Remind you of anyone you know ?
Cool Cat!!!!
Pretty poor blog eh ? Well, it was a boring day :S
| posted by merc, 11:30 AM
| 0 comments
|
Snowflake is dying :(
Copito de Nieve (Snowflake), the famous White Gorilla that lives in the Barcelona Zoo in Spain is dying.
The white albino gorilla was diagnosed with skincancer and has only a few weeks left to live.
Fourty years ago Snowflake was born in Equatorial Guinee in Africa. He/she's not only the only albino gorilla on earth, but also the first gorilla to be ever diagnosed with skincancer. But then again, albino's have a large risk of getting skincancer due to their delicate skin.
); Poor Copito de Nieve :(
Home Alone
Old news I know. But it just didn't fit in yesterdays deathrow.
A 2 year old toddler survived 3 weeks of being home alone. After her mother got arrested she did not mention she had a 2 year old daughter at home. After 19 days the father, who lives seperated from his daughter and hardly got to see her, went in search of his daughter after hearing of her mothers arrest.
On arriving at the apartment of his ex he found his daughter, naked and covered in mustard and ketchup, watching tv.
The little girl had survived the 19 days by eating food from the lowest cabinets and drawers, mostly dry macaroni and spaghetti, ketchup and mustard.
The mother is getting charged with child abuse (or endangerment or uhm something)
Holland enters cyberattack top 10.
Yes! We just hit #8 in the top 10 of countries that do cyberattacks.
We beat Taiwan out of the top 10, yay!
And #1 ? Duh! America with 51%!!!
Second are Germany and China with both 5%. The Netherlands reached 2%.
The entire top10 is responsible for 80% of all cyberattacks.
So-called Blended Threats are the most wide-spread. Two of these are the Slammer and Blaster, we all know and "love".
Slammer was able to crash many big systems worldwide within hours. And Blaster had a infection-rate of over 2500 computers per hour. Yay! Uhm, I mean, bastards!
According to Symantec this is only the beginning, sooner or later we will see more worms tearing down networks and attacking our internet access. Uh-oh!
Microsoft pays up...
Microsoft payed a settlement of 10,5 million dollars for overpricing the software they sold on their site and other direct selling points :P Silly Bill (pun intended)
Sharky...
Some Canadanian scientists found the oldest shark fossil to date. The 409 million year old fossil is from Devon and is some 20 million years older then the previously oldest. Sharks like this are called Doliodus Problematicus, cos early finds were hard to identify as sharks. Finds like this are rare cos most predator fish skeletons desolve cos the bone is weak (dunno the name right now :S) Lubly sharkses them though.
Dognapped or Dead Dawgs ?
According to animalfriends in Athens the Olympic commity is responsible for the death of 3000 stray dogs.
Athoc, the council that is preparing the city for the upcoming Olympics asked the Athens Council to prepare the city by cleaning it up, among the cleaning was the getting rid of the 10.000 stray dogs that roam around Athens. How they did it ? They killed em, poisoned em, burned and threw em in garbage containers. Hmm, now that aint nice, not nice at all....:S Athoc calls it slander, oh, and they get 1,8 million to deal with the dogs, and they caught 62 so far...and released em too, nice people eh ? Only 9938 to go, according to their story anyway...
Homosexual Necrofilia Duckus....
Oi!? Yea, well, uhm. This dutch professor guy won a fake dutch nobelprize for useless research.
One day a duck flew against the a large window of the university. The professor witnessed it and kept looking. What happened after that is what he did his research on...
The duck died, and another duck that was following it flew up to it, and started doing the dead duck. After raping it for 1 hour and 15 minutes it stopped and flew away....
Later researched showed that they where both male, so it was a clear case of....Homosexual Necrophelia, among ducks....
So yea, pretty useless if you ask me...
Great lyrics!!!! (?)
First one is by : 16 Down. Its a dutch band with a one-hit-wonder. The song is called Subtle Movements. Great stuff.
The subtle movements of her eyes said it all
Made my thoughts wonder of, couldn’t get enough
The perfume of this girl, in front of me, is killin’ me
This soultrip rolls along this road
Straight into the unknown is where I wanna go
I’m losing my head, losing my head over her
Spinning ‘round and ‘round so fast
When she touches me and I see her smile
She makes it all worthwhile
Spinning ‘round and ‘round so fast I believe she
Makes me whole, I never felt this much alive
So divine, she’s pure, she’s beautiful
And on days like this in the autumn winds
I feel that all I am is about her, about her
Spinning ‘round and ‘round so fast
When she touches me and I see her smile
She makes it all worthwhile
Spinning ‘round and ‘round so fast I believe she
Makes me whole, I never felt this much alive
She makes it all worthwhile……… (4x)
Spinning ‘round and ‘round so fast
When she touches me and I see her smile
She makes it all worthwhile
Spinning ‘round and ‘round so fast I believe she
Makes me whole, I never felt this much alive
Much alive
She makes me feel alive...
Second is : Judith by APC
You're such an inspiration for the ways
That I'll never ever choose to be
Oh so many ways for me to show you
How the savior has abandoned you
Fuck your God
Your Lord and your Christ
He did this
Took all you had and
Left you this way
Still you pray, you never stray
Never taste of the fruit
You never thought to question why
It's not like you killed someone
It's not like you drove a hateful spear into his side
Praise the one who left you
Broken down and paralyzed
He did it all for you
He did it all for you
Oh so many many ways for me to show you
How your dogma has abandoned you
Pray to your Christ, to your god
Never taste of the fruit
Never stray, never break
Never---choke on a lie
Even though he's the one who did this to you
You never thought to question why
Not like you killed someone
It's Not like you drove a spiteful spear into his side
Talk to Jesus Christ
As if he knows the reasons why
He did it all for you
Did it all for you
He did it all for you..
Third : Counting Crows - I wish i was a girl. I love the way they sing about suicide in this song...
The devil's in the dreaming
He tells you I'm not sleeping in my hotel room alone
With nothing to believe in
You dive into the traffic rising up
And it's so quiet
You're surprised
And then you wake
For all the things you're losing
You might as well resign yourself to try and make a change
I'm going down to Hollywood
They're gonna make a movie from the things that they find
Crawling round my brain
I wish I was a girl so that you could believe me
And I could shake this static everytime I try to sleep
I wish for all the world that I could say,
"Hey Elizabeth, you know, I'm doing alright these days. "
The devil's in the dreaming
You see yourself descending from a building to the ground
You watch the sky receding
You spin to see the traffic rising up
And it's so quiet
You're surprised
And then you wake
For all the things I'm losing
I might as well resign myself to try and make a change
But I'm going down to Hollywood
They're gonna make a movie from the things that they find
Crawling round my brain
I wish I was a girl so that you could believe me
And I could shake this static every time I try to sleep
I wish for all the world that I could say,
"Hey Elizabeth, you know, I'm doing alright these days. "
In one of these dreams, you forgive me
It makes me think of the bad decisions that keep you at home
How could anyone else have changed?
All these wrong conclusions that leave you alone
How could everyone rearrange?
How could everyone else have changed?
What I see I believe
For all the things I'm losing
I might as well resign myself to try and make a change
Well, I'm going down to Hollywood
They're gonna make a movie from the things that they find
Crawling around my brain
I wish I was a girl so that you could believe me
And I could shake this static everytime I try to sleep
I wish for all the world that I could say,
"Hey Elizabeth, you know, I'm doing alright these days. "
But I can't sleep at night
The Fourth is also by the Counting Crows. Its Round Here, its like a tiny movie soundtrack...
Step out the front door like a ghost
into the fog where no one notices
the contrast of white on white.
And in between the moon and you
the angels get a better view
of the crumbling difference between wrong and right.
I walk in the air between the rain
through myself and back again
Where? I don't know
Maria says she's dying
through the door I hear her crying
Why? I don't know
[Chorus]
Round here we always stand up straight
Round here something radiates
Maria came from Nashville with a suitcase in her hand
she said she'd like to meet a boy who looks like Elvis
she walks along the edge of where the ocean meets the land
just like she's walking on a wire in the circus
she parks her car outside of my house
takes her clothes off
says she's close to understanding Jesus
she knows she's just a little misunderstood
she has trouble acting normal when she's nervous
[Chorus:]
Round here we're carving out our names
Round here we all look the same
Round here we talk just like lions
But we sacrifice like lambs
Round here she's slipping through my hands
Sleeping children better run like the wind
out of the lightning dream
Mama's little baby better get herself in
out of the lightning
She says It's only in my head
She says Shhh I know it's only in my head
But the girl in car in the parking lot
says "Man you should try to take a shot
can't you see my walls are crumbling?"
Then she looks up at the building
and says she's thinking of jumping
She says she's tired of life
she must be tired of something
Round here she's always on my mind
Round here hey man got lots of time
Round here we're never sent to bed early
And nobody makes us wait
Round here we stay up very, very, very, very late
The fifth is by Elbow, a great english band. They have a sound that is a cross between radiohead and uhm, well, sad stuff. I think Mellon Collie and the infinite sadness should be their album name, not the Smashing Pumpkins' :) The song is called Scattered Black&Whites.
Been climbing trees I've skinned my knees
My hands are black the sun is going down
She scruffs my hair in the kitchen steam
She's listening to the dream I weaved today
Crosswords through the bathroom door
While someone sings the theme-tune to the news
And my sister buzzes through the room leaving perfume in the air
And that's what triggered this.
I come back here from time to time
I shelter here some days.
A high-back chair. He sits and stares
A thousand yards and whistles
Marching-band (Boom-ching)
Kneeling by and speaking up
He reaches out and I take a
Massive hand. Disjointed tales
That flit between short trousers
And a full dress uniform
And he talks of people ten years
Gone like I've known them all my life
Like scattered black 'n' whites….
Ill stop spamming now, just this last one : Green Lizard - Speak the Words. try getting the acoustic of this, great stuff.
I had enough words to say that I was sorry
I had enough ways to make it go away
But foolish pride has ruined the path before me
I guess the sun can only shine here once a day
I drowned myself in a wave of lost ambition
I filled your world with my hate and disbelief
I trapped my soul in an awkward disposition
And deep inside I hope that no one sees me
Can you feel the pain I hide
I laugh out loud but cry inside
No one's there to save me from my doubt
Cause I don't dare to speak the words out loud
Try to find me in my sorrow
Time won't take away the truth
Can't change the way that we are changing
I hope that we will finally learn to
Can you feel the pain I hide
I laugh out loud but cry inside
No one's there to save me from my doubt
Cause I'm too scared to speak the words out loud
I walk the dessert all alone
No place to rest my mind
The sun is burning in my soul, in my soul
Pride is our strongest thing in common
And time isn't always on our side
But tears are not the only answer
It's time you took this blindfold from me
Can you feel the pain I hide
I laugh out loud but cry inside
Will you be there to save me from my doubt
If I can learn to speak the words out loud
Out loud
I prolly have better lyrics in my collection, but i just skimmed through my most popular list for now :)
| posted by merc, 11:01 AM
| 0 comments
|