Writing to reach you

It''s a kind of magic... A magician was showing a trick in a the Amsterdam tram. He made his wallet go up in flames only to have reappear unburned. The trick wasnt satisfactory to one viewer, so he decided to help him out a bit. He asked the magician to do the trick again, as the magician got his well-filled wallet out again the man pulled a knife, grabbed the wallet, and made himself disappear along with the wallet....:P Teehee, silly ass, what kind of nutcase does tricks with his wallet or any other valuables in the metro ? I wouldnt even do it in church, let alone in the metro :P Uhm, yea... French are insane... PARIS (reuters) - French schools are cracking down on a craze among teenage girls to flash their midriffs and wear skimpy G-strings that peek brazenly out from above their low-cut trousers. OMG! I just blatently copy pasted that! Eep! But hey, whats worse, my c/p ing it, or the message itself ? Aha! Suicide postponed...? ST. PETERSBURG, Fla. (Reuters) - A suicide that was to have taken place during an internet rock concert Saturday night has been postponed, the Hell on Earth band said on its Web site. Oi!? A note on a link to the site said both events had been postponed for a week. Darn, this is becoming a long running news item....:S Funny news quote : "If you're doing drugs, it's kind of a drag. You're a slave. It's kind of a weak thing to do." -- comic actor JACK BLACK, recalling his own problems with drugs in the eighth grade. Duh, uhm, yea, kinda weak, uhm, yea, duh, uhm, blah, yea....kinda....i think... BAD!!!!! SANTIAGO, Chile (Reuters) - Chile's Catholic Church, which is waging a campaign to block passage of a law legalizing divorce, will stop airing a controversial advertisement that said children of divorced couples are more likely to become drug addicts and criminals. Just that bit though :) The rest will go on as usual, darn divorcees! Ironically, Chile's proposed divorce law would actually make it tougher to end a marriage, eliminating a loophole that tens of thousands of Chileans use to obtain a so-called nullity. Heh! Silly church people! Haha! Fighting the wrong thing, again! In a nullity proceeding a husband and wife swear before a judge that they were married in the wrong district, not the one they were living in at the time. Many Chilean judges, though aware the couple are lying, will then decree the marriage null and void. So uhm, arent the judges the loophole ? Hmmm... Kidnapped! MOSCOW (Reuters) - For a Russian electricity company, pets are not just for Christmas -- they are for ransom. Russia's First Channel television reported Dalenergo, an electricity company in Russia's Far Eastern city Vladivostok, is so frustrated by customers who owe around 300 million roubles (6 million pounds) that it has decided to confiscate their pets. "Let the father answer his daughter's question as to why her favourite cat has been taken away," Dalenergo Director Nikolai Tkachyov told First Channel. Teehee! That'll show em! Sad really :S Bad Doctor! Her name should have been a warning, but now a Spanish doctor has been ordered to pay 20-years child support to a woman called Concepcion who gave birth three years after he tried to sterilize her. Heh! Fool! Pardon my French... PARIS (Reuters) - Tired of being sniggered at, people from French villages whose names sound like "Filthy Swine" and "My Arse" plan a weekend get-together in a tiny hamlet whose name means "Eat Onions" in old French. Among the 15 or so villages joining the event in the southwestern village of Mengesebes (Eat Onions in Occitan, an old language from the south of France) are: Saligos (which sounds like Filthy Swine), Montcuq (sounds like My Arse) and Trecon (Very Stupid). Quirky French place names are nothing new to some English-speaking tourists who several times a year make off with signposts from the southwestern town of Condom. Lolz! Weirdo french, we have some weird towns too though...GroteGast (BigGuy) Sexbierum (uhm, SexBeerRum ? duh!) Meppen (Slapping) Dieren (Animals) De Engel (The Angel) Lollum (uhm, LOL ?) Handel (Merchandise) Monster (Monster ?) LutjesWinkel (uhm, hard to translate, uhm, Lutje = nowhere (as in nowhereville) winkel = store) Haren (Hairs) Oenkerk (NitwitChurch) Amerika (America ?) Helmond (Hellmouth, eat your heart out Buffy!) Boerenhol (Farmershole) Moddergat (Mudhole) Mooie Paal (Nice Pole, or nice dick, depends :P) Fonteinsnol (Fountainslut) Cocksdorp (Cocksville) Aarsmaderstrontveen (Assmaggotshit.... (dunno translation for veen, nothing special though)) Stampesgat (uhm, Bangershole) Glimmen (Shine) Doodstil (Deadquiet) Hongerige Wolf (Hungry Wolf) Electra (duh) Pannekoek (Pancake) Nooitgedacht (Neverthought) Muggenbeet (Musquitobite) Katlijk(Catcorpse) Sint-Nicolaasga (kinda uhm, Santa Fuck-off!) Hem (Him) Pluskut (Pluscunt) We cant beat Austria though, they have Fucking :( In Poland there is a little Island called Hell, people there earn money with greeting cards that say : Greetings from Hell, lolz! Switzerland has Kloten (Balls) and Spain has Peniscola (yea) No Name, Colorado Pis Pis River, Nicaragua Saint-Louis-du-Ha! Ha!, Quebec, Canada :P Then there is this place in Tjechia called Kutna Hora, in German its Kuttenberg, and Kuttenberg is CuntsMountain in dutch :) They have a weirdo church there filled with human bones : And Wales has silly little LLANFAIRPWLLGWYNGYLLGOGERYCHWYRNDROBWLLLLANTYSILIOGOGOGOCH (Mary's church by the white hazel pool, near the fierce whirlpool,whit the church of Tysilio by the red cave.) There is a station in Wales called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known. And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokai- whenuaakitanarahu in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit in Thailand (aka Bangkok)which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not. I bet you lot know quite a few more, so uhm, you aint posting anything anyway, so screw you! ;) | posted by merc, 10:46 AM